PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_25870V3.4.p
Common NamePHYPADRAFT_224453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YB
Protein Properties Length: 156aa    MW: 16693.8 Da    PI: 4.5019
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_25870V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB71.91e-221096490
              NF-YB  4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
                       +d  lP a +++i+k++lP + +++kda++++ ec +efi +++se+++ c +++++ti+++ +l al  lGf +y+ ++++  +++
  Pp3c3_25870V3.4.p 10 DDVSLPKATMTKIIKEMLPPDVRVAKDAQDLLVECCVEFINLISSESNEICSKDEKRTIAPEHVLRALEILGFGEYIGEVQAAYEQH 96
                       6889*************************************************************************9998765555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-378141IPR009072Histone-fold
SuperFamilySSF471131.8E-3310141IPR009072Histone-fold
PfamPF008081.3E-211377IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MDTAGSRPKD DVSLPKATMT KIIKEMLPPD VRVAKDAQDL LVECCVEFIN LISSESNEIC  60
SKDEKRTIAP EHVLRALEIL GFGEYIGEVQ AAYEQHKNES LESPKVGGRW AKEGGGGGMT  120
EEEAIAAQQR MFAEARARMN SGGAAAPAAQ ANDSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B3e-391013612133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001780865.11e-112predicted protein
SwissprotP495922e-72NC2B_ARATH; Protein Dr1 homolog
TrEMBLA9TQH01e-112A9TQH0_PHYPA; Predicted protein
STRINGPP1S288_38V6.11e-111(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.43e-63nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]